Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003479-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: E74-like factor 3 (ets domain transcription factor, epithelial-specific )
Gene Name: ELF3
Alternative Gene Name: EPR-1, ERT, ESE-1, ESX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003051: 86%, ENSRNOG00000006330: 74%
Entrez Gene ID: 1999
Uniprot ID: P78545
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMA
Gene Sequence ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMA
Gene ID - Mouse ENSMUSG00000003051
Gene ID - Rat ENSRNOG00000006330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation)
Datasheet Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation)
Datasheet Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation)
Citations for Anti ELF3 pAb (ATL-HPA003479 w/enhanced validation) – 5 Found
Diaferia, Giuseppe R; Balestrieri, Chiara; Prosperini, Elena; Nicoli, Paola; Spaggiari, Paola; Zerbi, Alessandro; Natoli, Gioacchino. Dissection of transcriptional and cis-regulatory control of differentiation in human pancreatic cancer. The Embo Journal. 2016;35(6):595-617.  PubMed
Liu, D; Skomorovska, Y; Song, J; Bowler, E; Harris, R; Ravasz, M; Bai, S; Ayati, M; Tamai, K; Koyuturk, M; Yuan, X; Wang, Z; Wang, Y; Ewing, R M. ELF3 is an antagonist of oncogenic-signalling-induced expression of EMT-TF ZEB1. Cancer Biology & Therapy. 20(1):90-100.  PubMed
Enfield, Katey S S; Marshall, Erin A; Anderson, Christine; Ng, Kevin W; Rahmati, Sara; Xu, Zhaolin; Fuller, Megan; Milne, Katy; Lu, Daniel; Shi, Rocky; Rowbotham, David A; Becker-Santos, Daiana D; Johnson, Fraser D; English, John C; MacAulay, Calum E; Lam, Stephen; Lockwood, William W; Chari, Raj; Karsan, Aly; Jurisica, Igor; Lam, Wan L. Epithelial tumor suppressor ELF3 is a lineage-specific amplified oncogene in lung adenocarcinoma. Nature Communications. 2019;10(1):5438.  PubMed
Hinley, Jennifer; Duke, Rosalind; Jinks, Jessica; Stahlschmidt, Jens; Keene, David; Cervellione, Raimondo M; Mushtaq, Imran; De Coppi, Paolo; Garriboli, Massimo; Southgate, Jennifer. Barrier-Forming Potential of Epithelial Cells from the Exstrophic Bladder. The American Journal Of Pathology. 2022;192(6):943-955.  PubMed
Matsumoto, Takeo; Iizuka, Takashi; Nakamura, Mitsuhiro; Suzuki, Takuma; Yamamoto, Megumi; Ono, Masanori; Kagami, Kyosuke; Kasama, Haruki; Wakae, Kousho; Muramatsu, Masamichi; Horike, Shin-Ichi; Kyo, Satoru; Yamamoto, Yasuhiko; Mizumoto, Yasunari; Daikoku, Takiko; Fujiwara, Hiroshi. FOXP4 inhibits squamous differentiation of atypical cells in cervical intraepithelial neoplasia via an ELF3-dependent pathway. Cancer Science. 2022;113(10):3376-3389.  PubMed