Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA071166-25
  • Immunohistochemical staining of human colon, lymph node, placenta and testis using Anti-ELF2 antibody HPA071166 (A) shows similar protein distribution across tissues to independent antibody HPA006057 (B).
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: E74-like factor 2 (ets domain transcription factor)
Gene Name: ELF2
Alternative Gene Name: EU32, NERF, NERF-1A, NERF-1B, NERF-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037174: 91%, ENSRNOG00000010815: 95%
Entrez Gene ID: 1998
Uniprot ID: Q15723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
Gene Sequence TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
Gene ID - Mouse ENSMUSG00000037174
Gene ID - Rat ENSRNOG00000010815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation)
Datasheet Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation)
Datasheet Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation)