Anti ELAVL4 pAb (ATL-HPA043047)

Atlas Antibodies

SKU: ATL-HPA043047-25

• 

Protein Description: ELAV like RNA binding protein 4
Gene Name: ELAVL4
Alternative Gene Name: HUD, PNEM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028546: 98%, ENSRNOG00000023601: 95%
Entrez Gene ID: 1996
Uniprot ID: P26378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK
• Gene Sequence: VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK
• Gene ID - Mouse: ENSMUSG00000028546
• Gene ID - Rat: ENSRNOG00000023601
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.