Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA063001-25

Protein Description: ELAV like neuron-specific RNA binding protein 2
Gene Name: ELAVL2
Alternative Gene Name: HEL-N1, HuB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008489: 99%, ENSRNOG00000006853: 99%
Entrez Gene ID: 1993
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL
• Gene Sequence: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL
• Gene ID - Mouse: ENSMUSG00000008489
• Gene ID - Rat: ENSRNOG00000006853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) – 2 Found

Jan, Sabrina Z; Vormer, Tinke L; Jongejan, Aldo; Röling, Michael D; Silber, Sherman J; de Rooij, Dirk G; Hamer, Geert; Repping, Sjoerd; van Pelt, Ans M M. Unraveling transcriptome dynamics in human spermatogenesis. Development (Cambridge, England). 2017;144(20):3659-3673. 

Pandit, Kunal; Petrescu, Joana; Cuevas, Miguel; Stephenson, William; Smibert, Peter; Phatnani, Hemali; Maniatis, Silas. An open source toolkit for repurposing Illumina sequencing systems as versatile fluidics and imaging platforms. Scientific Reports. 2022;12(1):5081.