Anti ELANE pAb (ATL-HPA066836 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA066836-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: elastase, neutrophil expressed
Gene Name: ELANE
Alternative Gene Name: ELA2, HLE, HNE, NE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020125: 65%, ENSRNOG00000033685: 63%
Entrez Gene ID: 1991
Uniprot ID: P08246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP
Gene Sequence LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP
Gene ID - Mouse ENSMUSG00000020125
Gene ID - Rat ENSRNOG00000033685
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELANE pAb (ATL-HPA066836 w/enhanced validation)
Datasheet Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ELANE pAb (ATL-HPA066836 w/enhanced validation)
Datasheet Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ELANE pAb (ATL-HPA066836 w/enhanced validation)