Anti ELANE pAb (ATL-HPA066836 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA066836-25

Protein Description: elastase, neutrophil expressed
Gene Name: ELANE
Alternative Gene Name: ELA2, HLE, HNE, NE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020125: 65%, ENSRNOG00000033685: 63%
Entrez Gene ID: 1991
Uniprot ID: P08246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP
• Gene Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP
• Gene ID - Mouse: ENSMUSG00000020125
• Gene ID - Rat: ENSRNOG00000033685
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.