Anti ELAC2 pAb (ATL-HPA019535)

Atlas Antibodies

Catalog No.:
ATL-HPA019535-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: elaC ribonuclease Z 2
Gene Name: ELAC2
Alternative Gene Name: FLJ10530, HPC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020549: 80%, ENSRNOG00000003424: 79%
Entrez Gene ID: 60528
Uniprot ID: Q9BQ52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR
Gene Sequence WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR
Gene ID - Mouse ENSMUSG00000020549
Gene ID - Rat ENSRNOG00000003424
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELAC2 pAb (ATL-HPA019535)
Datasheet Anti ELAC2 pAb (ATL-HPA019535) Datasheet (External Link)
Vendor Page Anti ELAC2 pAb (ATL-HPA019535) at Atlas Antibodies

Documents & Links for Anti ELAC2 pAb (ATL-HPA019535)
Datasheet Anti ELAC2 pAb (ATL-HPA019535) Datasheet (External Link)
Vendor Page Anti ELAC2 pAb (ATL-HPA019535)
Citations for Anti ELAC2 pAb (ATL-HPA019535) – 2 Found
Schroeder, Cornelia; Navid-Hill, Elham; Meiners, Jan; Hube-Magg, Claudia; Kluth, Martina; Makrypidi-Fraune, Georgia; Simon, Ronald; Büscheck, Franziska; Luebke, Andreas M; Goebel, Cosima; Lang, Dagmar S; Weidemann, Sören; Neubauer, Emily; Hinsch, Andrea; Jacobsen, Frank; Lebok, Patrick; Michl, Uwe; Pehrke, Dirk; Huland, Hartwig; Graefen, Markus; Schlomm, Thorsten; Sauter, Guido; Höflmayer, Doris. Nuclear ELAC2 overexpression is associated with increased hazard for relapse after radical prostatectomy. Oncotarget. 2019;10(48):4973-4986.  PubMed
Sanchez, Maria I G Lopez; Shearwood, Anne-Marie J; Chia, Tiongsun; Davies, Stefan M K; Rackham, Oliver; Filipovska, Aleksandra. Estrogen-mediated regulation of mitochondrial gene expression. Molecular Endocrinology (Baltimore, Md.). 2015;29(1):14-27.  PubMed