Anti ELAC1 pAb (ATL-HPA066483)

Atlas Antibodies

Catalog No.:
ATL-HPA066483-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: elaC ribonuclease Z 1
Gene Name: ELAC1
Alternative Gene Name: D29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036941: 85%, ENSRNOG00000000113: 84%
Entrez Gene ID: 55520
Uniprot ID: Q9H777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGF
Gene Sequence IWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGF
Gene ID - Mouse ENSMUSG00000036941
Gene ID - Rat ENSRNOG00000000113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELAC1 pAb (ATL-HPA066483)
Datasheet Anti ELAC1 pAb (ATL-HPA066483) Datasheet (External Link)
Vendor Page Anti ELAC1 pAb (ATL-HPA066483) at Atlas Antibodies

Documents & Links for Anti ELAC1 pAb (ATL-HPA066483)
Datasheet Anti ELAC1 pAb (ATL-HPA066483) Datasheet (External Link)
Vendor Page Anti ELAC1 pAb (ATL-HPA066483)