Anti EIF4E3 pAb (ATL-HPA058649)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058649-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EIF4E3
Alternative Gene Name: MGC39820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093661: 96%, ENSRNOG00000010301: 96%
Entrez Gene ID: 317649
Uniprot ID: Q8N5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY |
Gene Sequence | LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY |
Gene ID - Mouse | ENSMUSG00000093661 |
Gene ID - Rat | ENSRNOG00000010301 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF4E3 pAb (ATL-HPA058649) | |
Datasheet | Anti EIF4E3 pAb (ATL-HPA058649) Datasheet (External Link) |
Vendor Page | Anti EIF4E3 pAb (ATL-HPA058649) at Atlas Antibodies |
Documents & Links for Anti EIF4E3 pAb (ATL-HPA058649) | |
Datasheet | Anti EIF4E3 pAb (ATL-HPA058649) Datasheet (External Link) |
Vendor Page | Anti EIF4E3 pAb (ATL-HPA058649) |