Anti EIF4E2 pAb (ATL-HPA077074)

Atlas Antibodies

Catalog No.:
ATL-HPA077074-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 4E family member 2
Gene Name: EIF4E2
Alternative Gene Name: 4EHP, EIF4EL3, IF4e
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026254: 100%, ENSRNOG00000019634: 100%
Entrez Gene ID: 9470
Uniprot ID: O60573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT
Gene Sequence LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT
Gene ID - Mouse ENSMUSG00000026254
Gene ID - Rat ENSRNOG00000019634
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF4E2 pAb (ATL-HPA077074)
Datasheet Anti EIF4E2 pAb (ATL-HPA077074) Datasheet (External Link)
Vendor Page Anti EIF4E2 pAb (ATL-HPA077074) at Atlas Antibodies

Documents & Links for Anti EIF4E2 pAb (ATL-HPA077074)
Datasheet Anti EIF4E2 pAb (ATL-HPA077074) Datasheet (External Link)
Vendor Page Anti EIF4E2 pAb (ATL-HPA077074)