Anti EIF4E2 pAb (ATL-HPA077074)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077074-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EIF4E2
Alternative Gene Name: 4EHP, EIF4EL3, IF4e
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026254: 100%, ENSRNOG00000019634: 100%
Entrez Gene ID: 9470
Uniprot ID: O60573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT |
Gene Sequence | LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT |
Gene ID - Mouse | ENSMUSG00000026254 |
Gene ID - Rat | ENSRNOG00000019634 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF4E2 pAb (ATL-HPA077074) | |
Datasheet | Anti EIF4E2 pAb (ATL-HPA077074) Datasheet (External Link) |
Vendor Page | Anti EIF4E2 pAb (ATL-HPA077074) at Atlas Antibodies |
Documents & Links for Anti EIF4E2 pAb (ATL-HPA077074) | |
Datasheet | Anti EIF4E2 pAb (ATL-HPA077074) Datasheet (External Link) |
Vendor Page | Anti EIF4E2 pAb (ATL-HPA077074) |