RIP-CERTIFIED ANTIBODY: Posttranscriptional regulation of gene expression is a ribonucleoprotein-driven process, which involves RNA binding proteins (RBPs) and non-coding RNAs that affect splicing, nuclear export, subcellular localization, mRNA decay and translation. The RNP Immunoprecipitation-Chip (RIP-Chip), RIP-Seq and RIP-RTPCR allow the identification of multiple RNA targets of RBPs globally and within the context of a cell extract. Antibodies specific to the RNA binding protein of interest are used to co-immunoprecipitate the RNA binding protein and the associated subset of mRNAs. The mRNA content is interrogated using standard microarray or sequencing technology. RIP-Certified Antibody is validated for use in RNP Immunoprecipitation (RIP) in conjunction with the RIP-Assay Kit distributed from MBL. Its ability to immunoprecipitate mRNAs and RBPs complex was confirmed by quantitative and qualitative analysis on NanoDrop, Bioanalyzer and RT-PCR or microarray.

Product Specifications
Application ICC, IP, WB, RIP
Reactivity Human, Mouse, Rat, Hamster
Clonality Polyclonal
Host Rabbit
Source Polyclonal
Immunogen KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.)
Gene ID - Human

1977

Gene ID - Mouse

13684

Gene ID - Rat 117045
Formulation 200 μl volume of PBS containing 50% glycerol, pH 7.2. No preservative is contained.
Storage -20C

Documents & Links for Anti-EIF4E pAb
Datasheet Anti-EIF4E pAb Datasheet

Documents & Links for Anti-EIF4E pAb
Datasheet Anti-EIF4E pAb Datasheet
Citations for Anti-EIF4E pAb – 5 Found
Hayman, Thomas J; Williams, Eli S; Jamal, Muhammad; Shankavaram, Uma T; Camphausen, Kevin; Tofilon, Philip J. Translation initiation factor eIF4E is a target for tumor cell radiosensitization. Cancer Research. 2012;72(9):2362-72.  PubMed
Comments: Used in: RIP
Fukao, Akira; Mishima, Yuichiro; Takizawa, Naoki; Oka, Shigenori; Imataka, Hiroaki; Pelletier, Jerry; Sonenberg, Nahum; Thoma, Christian; Fujiwara, Toshinobu. MicroRNAs trigger dissociation of eIF4AI and eIF4AII from target mRNAs in humans. Molecular Cell. 2014;56(1):79-89.  PubMed
Comments: Used in: WB
Culjkovic-Kraljacic, Biljana; Fernando, Tharu M; Marullo, Rossella; Calvo-Vidal, Nieves; Verma, Akanksha; Yang, ShaoNing; Tabbò, Fabrizio; Gaudiano, Marcello; Zahreddine, Hiba; Goldstein, Rebecca L; Patel, Jayeshkumar; Taldone, Tony; Chiosis, Gabriela; Ladetto, Marco; Ghione, Paola; Machiorlatti, Rodolfo; Elemento, Olivier; Inghirami, Giorgio; Melnick, Ari; Borden, Katherine L B; Cerchietti, Leandro. Combinatorial targeting of nuclear export and translation of RNA inhibits aggressive B-cell lymphomas. Blood. 2016;127(7):858-68.  PubMed
Comments: Used in: RIP
Rissland, Olivia S; Subtelny, Alexander O; Wang, Miranda; Lugowski, Andrew; Nicholson, Beth; Laver, John D; Sidhu, Sachdev S; Smibert, Craig A; Lipshitz, Howard D; Bartel, David P. The influence of microRNAs and poly(A) tail length on endogenous mRNA-protein complexes. Genome Biology. 2017;18(1):211.  PubMed
Comments: Used in: RIP
Zahreddine, Hiba Ahmad; Culjkovic-Kraljacic, Biljana; Emond, Audrey; Pettersson, Filippa; Midura, Ronald; Lauer, Mark; Del Rincon, Sonia; Cali, Valbona; Assouline, Sarit; Miller, Wilson H; Hascall, Vincent; Borden, Katherine Lb. The eukaryotic translation initiation factor eIF4E harnesses hyaluronan production to drive its malignant activity. Elife. 2017;6  PubMed
Comments: Used in: RIP