| Product Specifications | |
| Application | ICC, IP, WB, RIP |
| Reactivity | Human, Mouse, Rat, Hamster |
| Clonality | Polyclonal |
| Host | Rabbit |
| Source | Polyclonal |
| Immunogen | KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.) |
| Gene ID - Human | |
| Gene ID - Mouse | |
| Gene ID - Rat | 117045 |
| Formulation | 200 μl volume of PBS containing 50% glycerol, pH 7.2. No preservative is contained. |
| Storage | -20C |
| Documents & Links for Anti-EIF4E pAb | |
| Datasheet | Anti-EIF4E pAb Datasheet |
| Documents & Links for Anti-EIF4E pAb | |
| Datasheet | Anti-EIF4E pAb Datasheet |
| Citations for Anti-EIF4E pAb – 5 Found |
| Hayman, Thomas J; Williams, Eli S; Jamal, Muhammad; Shankavaram, Uma T; Camphausen, Kevin; Tofilon, Philip J. Translation initiation factor eIF4E is a target for tumor cell radiosensitization. Cancer Research. 2012;72(9):2362-72. PubMed - Comments: Used in: RIP |
| Fukao, Akira; Mishima, Yuichiro; Takizawa, Naoki; Oka, Shigenori; Imataka, Hiroaki; Pelletier, Jerry; Sonenberg, Nahum; Thoma, Christian; Fujiwara, Toshinobu. MicroRNAs trigger dissociation of eIF4AI and eIF4AII from target mRNAs in humans. Molecular Cell. 2014;56(1):79-89. PubMed - Comments: Used in: WB |
| Culjkovic-Kraljacic, Biljana; Fernando, Tharu M; Marullo, Rossella; Calvo-Vidal, Nieves; Verma, Akanksha; Yang, ShaoNing; Tabbò, Fabrizio; Gaudiano, Marcello; Zahreddine, Hiba; Goldstein, Rebecca L; Patel, Jayeshkumar; Taldone, Tony; Chiosis, Gabriela; Ladetto, Marco; Ghione, Paola; Machiorlatti, Rodolfo; Elemento, Olivier; Inghirami, Giorgio; Melnick, Ari; Borden, Katherine L B; Cerchietti, Leandro. Combinatorial targeting of nuclear export and translation of RNA inhibits aggressive B-cell lymphomas. Blood. 2016;127(7):858-68. PubMed - Comments: Used in: RIP |
| Rissland, Olivia S; Subtelny, Alexander O; Wang, Miranda; Lugowski, Andrew; Nicholson, Beth; Laver, John D; Sidhu, Sachdev S; Smibert, Craig A; Lipshitz, Howard D; Bartel, David P. The influence of microRNAs and poly(A) tail length on endogenous mRNA-protein complexes. Genome Biology. 2017;18(1):211. PubMed - Comments: Used in: RIP |
| Zahreddine, Hiba Ahmad; Culjkovic-Kraljacic, Biljana; Emond, Audrey; Pettersson, Filippa; Midura, Ronald; Lauer, Mark; Del Rincon, Sonia; Cali, Valbona; Assouline, Sarit; Miller, Wilson H; Hascall, Vincent; Borden, Katherine Lb. The eukaryotic translation initiation factor eIF4E harnesses hyaluronan production to drive its malignant activity. Elife. 2017;6 PubMed - Comments: Used in: RIP |