Anti EIF3M pAb (ATL-HPA031063)

Atlas Antibodies

SKU:
ATL-HPA031063-100
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit M
Gene Name: EIF3M
Alternative Gene Name: eIF3m, FLJ29030, GA17, hfl-B5, PCID1, TANGO7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027170: 99%, ENSRNOG00000012738: 99%
Entrez Gene ID: 10480
Uniprot ID: Q7L2H7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKS
Gene Sequence GGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKS
Gene ID - Mouse ENSMUSG00000027170
Gene ID - Rat ENSRNOG00000012738
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF3M pAb (ATL-HPA031063)
Datasheet Anti EIF3M pAb (ATL-HPA031063) Datasheet (External Link)
Vendor Page Anti EIF3M pAb (ATL-HPA031063) at Atlas Antibodies

Documents & Links for Anti EIF3M pAb (ATL-HPA031063)
Datasheet Anti EIF3M pAb (ATL-HPA031063) Datasheet (External Link)
Vendor Page Anti EIF3M pAb (ATL-HPA031063)