Anti EIF3C pAb (ATL-HPA049495)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049495-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: EIF3C
Alternative Gene Name: eIF3-p110, eIF3c, EIF3S8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030738: 97%, ENSRNOG00000018761: 96%
Entrez Gene ID: 8663
Uniprot ID: Q99613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLA |
Gene Sequence | EEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLA |
Gene ID - Mouse | ENSMUSG00000030738 |
Gene ID - Rat | ENSRNOG00000018761 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF3C pAb (ATL-HPA049495) | |
Datasheet | Anti EIF3C pAb (ATL-HPA049495) Datasheet (External Link) |
Vendor Page | Anti EIF3C pAb (ATL-HPA049495) at Atlas Antibodies |
Documents & Links for Anti EIF3C pAb (ATL-HPA049495) | |
Datasheet | Anti EIF3C pAb (ATL-HPA049495) Datasheet (External Link) |
Vendor Page | Anti EIF3C pAb (ATL-HPA049495) |