Anti EIF3C pAb (ATL-HPA049495)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049495-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: EIF3C
Alternative Gene Name: eIF3-p110, eIF3c, EIF3S8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030738: 97%, ENSRNOG00000018761: 96%
Entrez Gene ID: 8663
Uniprot ID: Q99613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLA |
| Gene Sequence | EEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLA |
| Gene ID - Mouse | ENSMUSG00000030738 |
| Gene ID - Rat | ENSRNOG00000018761 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF3C pAb (ATL-HPA049495) | |
| Datasheet | Anti EIF3C pAb (ATL-HPA049495) Datasheet (External Link) |
| Vendor Page | Anti EIF3C pAb (ATL-HPA049495) at Atlas Antibodies |
| Documents & Links for Anti EIF3C pAb (ATL-HPA049495) | |
| Datasheet | Anti EIF3C pAb (ATL-HPA049495) Datasheet (External Link) |
| Vendor Page | Anti EIF3C pAb (ATL-HPA049495) |