Anti EIF2S2 pAb (ATL-HPA041332)

Atlas Antibodies

SKU: ATL-HPA041332-25

• 
• 

Protein Description: eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Gene Name: EIF2S2
Alternative Gene Name: EIF2, EIF2beta, PPP1R67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074656: 95%, ENSRNOG00000017447: 99%
Entrez Gene ID: 8894
Uniprot ID: P20042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK
• Gene Sequence: DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK
• Gene ID - Mouse: ENSMUSG00000074656
• Gene ID - Rat: ENSRNOG00000017447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.