Anti EIF2S2 pAb (ATL-HPA041332)

Atlas Antibodies

Catalog No.:
ATL-HPA041332-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Gene Name: EIF2S2
Alternative Gene Name: EIF2, EIF2beta, PPP1R67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074656: 95%, ENSRNOG00000017447: 99%
Entrez Gene ID: 8894
Uniprot ID: P20042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK
Gene Sequence DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK
Gene ID - Mouse ENSMUSG00000074656
Gene ID - Rat ENSRNOG00000017447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF2S2 pAb (ATL-HPA041332)
Datasheet Anti EIF2S2 pAb (ATL-HPA041332) Datasheet (External Link)
Vendor Page Anti EIF2S2 pAb (ATL-HPA041332) at Atlas Antibodies

Documents & Links for Anti EIF2S2 pAb (ATL-HPA041332)
Datasheet Anti EIF2S2 pAb (ATL-HPA041332) Datasheet (External Link)
Vendor Page Anti EIF2S2 pAb (ATL-HPA041332)