Anti EIF2S2 pAb (ATL-HPA041332)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041332-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EIF2S2
Alternative Gene Name: EIF2, EIF2beta, PPP1R67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074656: 95%, ENSRNOG00000017447: 99%
Entrez Gene ID: 8894
Uniprot ID: P20042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK |
Gene Sequence | DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK |
Gene ID - Mouse | ENSMUSG00000074656 |
Gene ID - Rat | ENSRNOG00000017447 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF2S2 pAb (ATL-HPA041332) | |
Datasheet | Anti EIF2S2 pAb (ATL-HPA041332) Datasheet (External Link) |
Vendor Page | Anti EIF2S2 pAb (ATL-HPA041332) at Atlas Antibodies |
Documents & Links for Anti EIF2S2 pAb (ATL-HPA041332) | |
Datasheet | Anti EIF2S2 pAb (ATL-HPA041332) Datasheet (External Link) |
Vendor Page | Anti EIF2S2 pAb (ATL-HPA041332) |