Anti EIF2B5 pAb (ATL-HPA064370)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064370-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EIF2B5
Alternative Gene Name: EIF-2B, EIF2Bepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003235: 90%, ENSRNOG00000038160: 88%
Entrez Gene ID: 8893
Uniprot ID: Q13144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPD |
| Gene Sequence | SILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPD |
| Gene ID - Mouse | ENSMUSG00000003235 |
| Gene ID - Rat | ENSRNOG00000038160 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF2B5 pAb (ATL-HPA064370) | |
| Datasheet | Anti EIF2B5 pAb (ATL-HPA064370) Datasheet (External Link) |
| Vendor Page | Anti EIF2B5 pAb (ATL-HPA064370) at Atlas Antibodies |
| Documents & Links for Anti EIF2B5 pAb (ATL-HPA064370) | |
| Datasheet | Anti EIF2B5 pAb (ATL-HPA064370) Datasheet (External Link) |
| Vendor Page | Anti EIF2B5 pAb (ATL-HPA064370) |