Anti EIF2B1 pAb (ATL-HPA049509)

Atlas Antibodies

Catalog No.:
ATL-HPA049509-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
Gene Name: EIF2B1
Alternative Gene Name: EIF-2B, EIF-2Balpha, EIF2B, EIF2BA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029388: 95%, ENSRNOG00000001039: 95%
Entrez Gene ID: 1967
Uniprot ID: Q14232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Gene Sequence AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Gene ID - Mouse ENSMUSG00000029388
Gene ID - Rat ENSRNOG00000001039
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF2B1 pAb (ATL-HPA049509)
Datasheet Anti EIF2B1 pAb (ATL-HPA049509) Datasheet (External Link)
Vendor Page Anti EIF2B1 pAb (ATL-HPA049509) at Atlas Antibodies

Documents & Links for Anti EIF2B1 pAb (ATL-HPA049509)
Datasheet Anti EIF2B1 pAb (ATL-HPA049509) Datasheet (External Link)
Vendor Page Anti EIF2B1 pAb (ATL-HPA049509)