Anti EIF2B1 pAb (ATL-HPA049509)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049509-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EIF2B1
Alternative Gene Name: EIF-2B, EIF-2Balpha, EIF2B, EIF2BA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029388: 95%, ENSRNOG00000001039: 95%
Entrez Gene ID: 1967
Uniprot ID: Q14232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL |
| Gene Sequence | AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL |
| Gene ID - Mouse | ENSMUSG00000029388 |
| Gene ID - Rat | ENSRNOG00000001039 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF2B1 pAb (ATL-HPA049509) | |
| Datasheet | Anti EIF2B1 pAb (ATL-HPA049509) Datasheet (External Link) |
| Vendor Page | Anti EIF2B1 pAb (ATL-HPA049509) at Atlas Antibodies |
| Documents & Links for Anti EIF2B1 pAb (ATL-HPA049509) | |
| Datasheet | Anti EIF2B1 pAb (ATL-HPA049509) Datasheet (External Link) |
| Vendor Page | Anti EIF2B1 pAb (ATL-HPA049509) |