Anti EIF2AK2 pAb (ATL-HPA063893)

Atlas Antibodies

SKU: ATL-HPA063893-25

• 

Protein Description: eukaryotic translation initiation factor 2-alpha kinase 2
Gene Name: EIF2AK2
Alternative Gene Name: EIF2AK1, PKR, PPP1R83, PRKR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024079: 53%, ENSRNOG00000048315: 60%
Entrez Gene ID: 5610
Uniprot ID: P19525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVD
• Gene Sequence: VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVD
• Gene ID - Mouse: ENSMUSG00000024079
• Gene ID - Rat: ENSRNOG00000048315
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.