Anti EIF1AX pAb (ATL-HPA002561)

Atlas Antibodies

Catalog No.:
ATL-HPA002561-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 1A, X-linked
Gene Name: EIF1AX
Alternative Gene Name: eIF-1A, eIF-4C, EIF1A, EIF4C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067194: 99%, ENSRNOG00000005736: 99%
Entrez Gene ID: 1964
Uniprot ID: P47813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
Gene Sequence KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
Gene ID - Mouse ENSMUSG00000067194
Gene ID - Rat ENSRNOG00000005736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF1AX pAb (ATL-HPA002561)
Datasheet Anti EIF1AX pAb (ATL-HPA002561) Datasheet (External Link)
Vendor Page Anti EIF1AX pAb (ATL-HPA002561) at Atlas Antibodies

Documents & Links for Anti EIF1AX pAb (ATL-HPA002561)
Datasheet Anti EIF1AX pAb (ATL-HPA002561) Datasheet (External Link)
Vendor Page Anti EIF1AX pAb (ATL-HPA002561)