Anti EIF1AX pAb (ATL-HPA002561)

Atlas Antibodies

SKU: ATL-HPA002561-25

• 
• 

Protein Description: eukaryotic translation initiation factor 1A, X-linked
Gene Name: EIF1AX
Alternative Gene Name: eIF-1A, eIF-4C, EIF1A, EIF4C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067194: 99%, ENSRNOG00000005736: 99%
Entrez Gene ID: 1964
Uniprot ID: P47813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
• Gene Sequence: KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
• Gene ID - Mouse: ENSMUSG00000067194
• Gene ID - Rat: ENSRNOG00000005736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.