Anti EID3 pAb (ATL-HPA059367)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059367-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: EID3
Alternative Gene Name: FLJ25832, NSE4B, NSMCE4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109864: 60%, ENSRNOG00000020452: 32%
Entrez Gene ID: 493861
Uniprot ID: Q8N140
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA |
| Gene Sequence | PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA |
| Gene ID - Mouse | ENSMUSG00000109864 |
| Gene ID - Rat | ENSRNOG00000020452 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EID3 pAb (ATL-HPA059367) | |
| Datasheet | Anti EID3 pAb (ATL-HPA059367) Datasheet (External Link) |
| Vendor Page | Anti EID3 pAb (ATL-HPA059367) at Atlas Antibodies |
| Documents & Links for Anti EID3 pAb (ATL-HPA059367) | |
| Datasheet | Anti EID3 pAb (ATL-HPA059367) Datasheet (External Link) |
| Vendor Page | Anti EID3 pAb (ATL-HPA059367) |