Anti EID3 pAb (ATL-HPA059367)

Atlas Antibodies

Catalog No.:
ATL-HPA059367-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EP300 interacting inhibitor of differentiation 3
Gene Name: EID3
Alternative Gene Name: FLJ25832, NSE4B, NSMCE4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109864: 60%, ENSRNOG00000020452: 32%
Entrez Gene ID: 493861
Uniprot ID: Q8N140
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
Gene Sequence PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
Gene ID - Mouse ENSMUSG00000109864
Gene ID - Rat ENSRNOG00000020452
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EID3 pAb (ATL-HPA059367)
Datasheet Anti EID3 pAb (ATL-HPA059367) Datasheet (External Link)
Vendor Page Anti EID3 pAb (ATL-HPA059367) at Atlas Antibodies

Documents & Links for Anti EID3 pAb (ATL-HPA059367)
Datasheet Anti EID3 pAb (ATL-HPA059367) Datasheet (External Link)
Vendor Page Anti EID3 pAb (ATL-HPA059367)