Anti EID3 pAb (ATL-HPA059367)

Atlas Antibodies

SKU: ATL-HPA059367-25

• 
• 

Protein Description: EP300 interacting inhibitor of differentiation 3
Gene Name: EID3
Alternative Gene Name: FLJ25832, NSE4B, NSMCE4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109864: 60%, ENSRNOG00000020452: 32%
Entrez Gene ID: 493861
Uniprot ID: Q8N140
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
• Gene Sequence: PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
• Gene ID - Mouse: ENSMUSG00000109864
• Gene ID - Rat: ENSRNOG00000020452
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.