Anti EID2B pAb (ATL-HPA064185)

Atlas Antibodies

SKU:
ATL-HPA064185-25
  • Immunohistochemical staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EP300 interacting inhibitor of differentiation 2B
Gene Name: EID2B
Alternative Gene Name: EID-3, FLJ38944
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070705: 53%, ENSRNOG00000045545: 56%
Entrez Gene ID: 126272
Uniprot ID: Q96D98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
Gene Sequence QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
Gene ID - Mouse ENSMUSG00000070705
Gene ID - Rat ENSRNOG00000045545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EID2B pAb (ATL-HPA064185)
Datasheet Anti EID2B pAb (ATL-HPA064185) Datasheet (External Link)
Vendor Page Anti EID2B pAb (ATL-HPA064185) at Atlas Antibodies

Documents & Links for Anti EID2B pAb (ATL-HPA064185)
Datasheet Anti EID2B pAb (ATL-HPA064185) Datasheet (External Link)
Vendor Page Anti EID2B pAb (ATL-HPA064185)