Anti EID2B pAb (ATL-HPA064185)

Atlas Antibodies

Catalog No.: ATL-HPA064185-25

Protein Description: EP300 interacting inhibitor of differentiation 2B
Gene Name: EID2B
Alternative Gene Name: EID-3, FLJ38944
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070705: 53%, ENSRNOG00000045545: 56%
Entrez Gene ID: 126272
Uniprot ID: Q96D98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
• Gene Sequence: QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
• Gene ID - Mouse: ENSMUSG00000070705
• Gene ID - Rat: ENSRNOG00000045545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.