Anti EID1 pAb (ATL-HPA051122)

Atlas Antibodies

Catalog No.: ATL-HPA051122-25

Protein Description: EP300 interacting inhibitor of differentiation 1
Gene Name: EID1
Alternative Gene Name: C15orf3, CRI1, EID-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091337: 45%, ENSRNOG00000008452: 48%
Entrez Gene ID: 23741
Uniprot ID: Q9Y6B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
• Gene Sequence: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
• Gene ID - Mouse: ENSMUSG00000091337
• Gene ID - Rat: ENSRNOG00000008452
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.