Anti EID1 pAb (ATL-HPA051122)

Atlas Antibodies

Catalog No.:
ATL-HPA051122-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: EP300 interacting inhibitor of differentiation 1
Gene Name: EID1
Alternative Gene Name: C15orf3, CRI1, EID-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091337: 45%, ENSRNOG00000008452: 48%
Entrez Gene ID: 23741
Uniprot ID: Q9Y6B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
Gene Sequence MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
Gene ID - Mouse ENSMUSG00000091337
Gene ID - Rat ENSRNOG00000008452
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EID1 pAb (ATL-HPA051122)
Datasheet Anti EID1 pAb (ATL-HPA051122) Datasheet (External Link)
Vendor Page Anti EID1 pAb (ATL-HPA051122) at Atlas Antibodies

Documents & Links for Anti EID1 pAb (ATL-HPA051122)
Datasheet Anti EID1 pAb (ATL-HPA051122) Datasheet (External Link)
Vendor Page Anti EID1 pAb (ATL-HPA051122)