Anti EI24 pAb (ATL-HPA047165)

Atlas Antibodies

Catalog No.:
ATL-HPA047165-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: etoposide induced 2.4
Gene Name: EI24
Alternative Gene Name: EPG4, PIG8, TP53I8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062762: 95%, ENSRNOG00000030391: 96%
Entrez Gene ID: 9538
Uniprot ID: O14681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRI
Gene Sequence GIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRI
Gene ID - Mouse ENSMUSG00000062762
Gene ID - Rat ENSRNOG00000030391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EI24 pAb (ATL-HPA047165)
Datasheet Anti EI24 pAb (ATL-HPA047165) Datasheet (External Link)
Vendor Page Anti EI24 pAb (ATL-HPA047165) at Atlas Antibodies

Documents & Links for Anti EI24 pAb (ATL-HPA047165)
Datasheet Anti EI24 pAb (ATL-HPA047165) Datasheet (External Link)
Vendor Page Anti EI24 pAb (ATL-HPA047165)