Anti EHMT1 pAb (ATL-HPA074729)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074729-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EHMT1
Alternative Gene Name: bA188C12.1, EHMT1-IT1, Eu-HMTase1, FLJ12879, FLJ40292, KIAA1876, KMT1D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036893: 90%, ENSRNOG00000007242: 92%
Entrez Gene ID: 79813
Uniprot ID: Q9H9B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV |
Gene Sequence | DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV |
Gene ID - Mouse | ENSMUSG00000036893 |
Gene ID - Rat | ENSRNOG00000007242 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EHMT1 pAb (ATL-HPA074729) | |
Datasheet | Anti EHMT1 pAb (ATL-HPA074729) Datasheet (External Link) |
Vendor Page | Anti EHMT1 pAb (ATL-HPA074729) at Atlas Antibodies |
Documents & Links for Anti EHMT1 pAb (ATL-HPA074729) | |
Datasheet | Anti EHMT1 pAb (ATL-HPA074729) Datasheet (External Link) |
Vendor Page | Anti EHMT1 pAb (ATL-HPA074729) |