Anti EHMT1 pAb (ATL-HPA074729)

Atlas Antibodies

Catalog No.: ATL-HPA074729-25

Protein Description: euchromatic histone lysine methyltransferase 1
Gene Name: EHMT1
Alternative Gene Name: bA188C12.1, EHMT1-IT1, Eu-HMTase1, FLJ12879, FLJ40292, KIAA1876, KMT1D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036893: 90%, ENSRNOG00000007242: 92%
Entrez Gene ID: 79813
Uniprot ID: Q9H9B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV
• Gene Sequence: DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV
• Gene ID - Mouse: ENSMUSG00000036893
• Gene ID - Rat: ENSRNOG00000007242
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.