Anti EHHADH pAb (ATL-HPA036401 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036401-25
  • Immunohistochemistry analysis in human liver and cerebral cortex tissues using Anti-EHHADH antibody. Corresponding EHHADH RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Gene Name: EHHADH
Alternative Gene Name: ECHD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022853: 68%, ENSRNOG00000001770: 66%
Entrez Gene ID: 1962
Uniprot ID: Q08426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVG
Gene Sequence TSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVG
Gene ID - Mouse ENSMUSG00000022853
Gene ID - Rat ENSRNOG00000001770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti EHHADH pAb (ATL-HPA036401 w/enhanced validation)
Datasheet Anti EHHADH pAb (ATL-HPA036401 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EHHADH pAb (ATL-HPA036401 w/enhanced validation)