Anti EHD4 pAb (ATL-HPA052729)

Atlas Antibodies

Catalog No.:
ATL-HPA052729-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EH-domain containing 4
Gene Name: EHD4
Alternative Gene Name: PAST4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027293: 96%, ENSRNOG00000007584: 96%
Entrez Gene ID: 30844
Uniprot ID: Q9H223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGKENKKRELISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFH
Gene Sequence FGKENKKRELISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFH
Gene ID - Mouse ENSMUSG00000027293
Gene ID - Rat ENSRNOG00000007584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EHD4 pAb (ATL-HPA052729)
Datasheet Anti EHD4 pAb (ATL-HPA052729) Datasheet (External Link)
Vendor Page Anti EHD4 pAb (ATL-HPA052729) at Atlas Antibodies

Documents & Links for Anti EHD4 pAb (ATL-HPA052729)
Datasheet Anti EHD4 pAb (ATL-HPA052729) Datasheet (External Link)
Vendor Page Anti EHD4 pAb (ATL-HPA052729)