Anti EHD3 pAb (ATL-HPA049890)

Atlas Antibodies

Catalog No.:
ATL-HPA049890-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: EH-domain containing 3
Gene Name: EHD3
Alternative Gene Name: PAST3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024065: 96%, ENSRNOG00000007744: 96%
Entrez Gene ID: 30845
Uniprot ID: Q9NZN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRY
Gene Sequence KLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRY
Gene ID - Mouse ENSMUSG00000024065
Gene ID - Rat ENSRNOG00000007744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EHD3 pAb (ATL-HPA049890)
Datasheet Anti EHD3 pAb (ATL-HPA049890) Datasheet (External Link)
Vendor Page Anti EHD3 pAb (ATL-HPA049890) at Atlas Antibodies

Documents & Links for Anti EHD3 pAb (ATL-HPA049890)
Datasheet Anti EHD3 pAb (ATL-HPA049890) Datasheet (External Link)
Vendor Page Anti EHD3 pAb (ATL-HPA049890)