Anti EHD1 pAb (ATL-HPA066751)

Atlas Antibodies

Catalog No.:
ATL-HPA066751-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: EH-domain containing 1
Gene Name: EHD1
Alternative Gene Name: FLJ42622, FLJ44618, H-PAST, HPAST1, PAST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024065: 99%, ENSRNOG00000007744: 99%
Entrez Gene ID: 10938
Uniprot ID: Q9H4M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH
Gene Sequence FVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH
Gene ID - Mouse ENSMUSG00000024065
Gene ID - Rat ENSRNOG00000007744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EHD1 pAb (ATL-HPA066751)
Datasheet Anti EHD1 pAb (ATL-HPA066751) Datasheet (External Link)
Vendor Page Anti EHD1 pAb (ATL-HPA066751) at Atlas Antibodies

Documents & Links for Anti EHD1 pAb (ATL-HPA066751)
Datasheet Anti EHD1 pAb (ATL-HPA066751) Datasheet (External Link)
Vendor Page Anti EHD1 pAb (ATL-HPA066751)