Anti EHBP1 pAb (ATL-HPA035469 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035469-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EH domain binding protein 1
Gene Name: EHBP1
Alternative Gene Name: KIAA0903, NACSIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042302: 84%, ENSRNOG00000008917: 62%
Entrez Gene ID: 23301
Uniprot ID: Q8NDI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen MRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFV
Gene Sequence MRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFV
Gene ID - Mouse ENSMUSG00000042302
Gene ID - Rat ENSRNOG00000008917
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EHBP1 pAb (ATL-HPA035469 w/enhanced validation)
Datasheet Anti EHBP1 pAb (ATL-HPA035469 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EHBP1 pAb (ATL-HPA035469 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EHBP1 pAb (ATL-HPA035469 w/enhanced validation)
Datasheet Anti EHBP1 pAb (ATL-HPA035469 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EHBP1 pAb (ATL-HPA035469 w/enhanced validation)