Anti EGR4 pAb (ATL-HPA028983 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028983-25

• 

Protein Description: early growth response 4
Gene Name: EGR4
Alternative Gene Name: NGFI-C, PAT133
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071341: 76%, ENSRNOG00000015719: 79%
Entrez Gene ID: 1961
Uniprot ID: Q05215
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL
• Gene Sequence: PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL
• Gene ID - Mouse: ENSMUSG00000071341
• Gene ID - Rat: ENSRNOG00000015719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.