Anti EGR3 pAb (ATL-HPA006206)

Atlas Antibodies

SKU:
ATL-HPA006206-25
  • Immunohistochemical staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: early growth response 3
Gene Name: EGR3
Alternative Gene Name: PILOT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033730: 100%, ENSRNOG00000017828: 100%
Entrez Gene ID: 1960
Uniprot ID: Q06889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSD
Gene Sequence EPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSD
Gene ID - Mouse ENSMUSG00000033730
Gene ID - Rat ENSRNOG00000017828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EGR3 pAb (ATL-HPA006206)
Datasheet Anti EGR3 pAb (ATL-HPA006206) Datasheet (External Link)
Vendor Page Anti EGR3 pAb (ATL-HPA006206) at Atlas Antibodies

Documents & Links for Anti EGR3 pAb (ATL-HPA006206)
Datasheet Anti EGR3 pAb (ATL-HPA006206) Datasheet (External Link)
Vendor Page Anti EGR3 pAb (ATL-HPA006206)



Citations for Anti EGR3 pAb (ATL-HPA006206) – 1 Found
Pio, Rebecca; Jia, Zhenyu; Baron, Veronique T; Mercola, Dan. Early growth response 3 (Egr3) is highly over-expressed in non-relapsing prostate cancer but not in relapsing prostate cancer. Plos One. 8(1):e54096.  PubMed