Anti EGLN2 pAb (ATL-HPA056649)

Atlas Antibodies

Catalog No.:
ATL-HPA056649-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: egl-9 family hypoxia-inducible factor 2
Gene Name: EGLN2
Alternative Gene Name: HIFPH1, PHD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058709: 78%, ENSRNOG00000020947: 79%
Entrez Gene ID: 112398
Uniprot ID: Q96KS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE
Gene Sequence PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE
Gene ID - Mouse ENSMUSG00000058709
Gene ID - Rat ENSRNOG00000020947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EGLN2 pAb (ATL-HPA056649)
Datasheet Anti EGLN2 pAb (ATL-HPA056649) Datasheet (External Link)
Vendor Page Anti EGLN2 pAb (ATL-HPA056649) at Atlas Antibodies

Documents & Links for Anti EGLN2 pAb (ATL-HPA056649)
Datasheet Anti EGLN2 pAb (ATL-HPA056649) Datasheet (External Link)
Vendor Page Anti EGLN2 pAb (ATL-HPA056649)