Anti EGLN2 pAb (ATL-HPA056649)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056649-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EGLN2
Alternative Gene Name: HIFPH1, PHD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058709: 78%, ENSRNOG00000020947: 79%
Entrez Gene ID: 112398
Uniprot ID: Q96KS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE |
Gene Sequence | PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE |
Gene ID - Mouse | ENSMUSG00000058709 |
Gene ID - Rat | ENSRNOG00000020947 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EGLN2 pAb (ATL-HPA056649) | |
Datasheet | Anti EGLN2 pAb (ATL-HPA056649) Datasheet (External Link) |
Vendor Page | Anti EGLN2 pAb (ATL-HPA056649) at Atlas Antibodies |
Documents & Links for Anti EGLN2 pAb (ATL-HPA056649) | |
Datasheet | Anti EGLN2 pAb (ATL-HPA056649) Datasheet (External Link) |
Vendor Page | Anti EGLN2 pAb (ATL-HPA056649) |