Anti EGFR pAb (ATL-HPA018530 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018530-100
- Shipping:
- Calculated at Checkout
$520.00
Gene Name: EGFR
Alternative Gene Name: ERBB, ERBB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020122: 84%, ENSRNOG00000004332: 82%
Entrez Gene ID: 1956
Uniprot ID: P00533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD |
| Gene Sequence | QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD |
| Gene ID - Mouse | ENSMUSG00000020122 |
| Gene ID - Rat | ENSRNOG00000004332 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EGFR pAb (ATL-HPA018530 w/enhanced validation) | |
| Datasheet | Anti EGFR pAb (ATL-HPA018530 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EGFR pAb (ATL-HPA018530 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EGFR pAb (ATL-HPA018530 w/enhanced validation) | |
| Datasheet | Anti EGFR pAb (ATL-HPA018530 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EGFR pAb (ATL-HPA018530 w/enhanced validation) |
| Citations for Anti EGFR pAb (ATL-HPA018530 w/enhanced validation) – 13 Found |
| Polisetty, Ravindra Varma; Gautam, Poonam; Gupta, Manoj Kumar; Sharma, Rakesh; Gowda, Harsha; Renu, Durairaj; Shivakumar, Bhadravathi Marigowda; Lakshmikantha, Akhila; Mariswamappa, Kiran; Ankathi, Praveen; Purohit, Aniruddh K; Uppin, Megha S; Sundaram, Challa; Sirdeshmukh, Ravi. Microsomal membrane proteome of low grade diffuse astrocytomas: Differentially expressed proteins and candidate surveillance biomarkers. Scientific Reports. 2016;6( 27246909):26882. PubMed |
| Huang, Li-Chi; Tam, Ka-Wai; Liu, Wei-Ni; Lin, Chun-Yu; Hsu, Kai-Wen; Hsieh, Wen-Shyang; Chi, Wei-Ming; Lee, Ai-Wei; Yang, Jinn-Moon; Lin, Ching-Ling; Lee, Chia-Hwa. CRISPR/Cas9 Genome Editing of Epidermal Growth Factor Receptor Sufficiently Abolished Oncogenicity in Anaplastic Thyroid Cancer. Disease Markers. 2018( 29849821):3835783. PubMed |
| Jablonska, Karolina; Nowinska, Katarzyna; Piotrowska, Aleksandra; Partynska, Aleksandra; Katnik, Ewa; Pawelczyk, Konrad; Glatzel-Plucinska, Natalia; Podhorska-Okolow, Marzenna; Dziegiel, Piotr. Prognostic Impact of Melatonin Receptors MT1 and MT2 in Non-Small Cell Lung Cancer (NSCLC). Cancers. 2019;11(7) PubMed |
| Gupta, Manoj Kumar; Polisetty, Ravindra Varma; Sharma, Rakesh; Ganesh, Raksha A; Gowda, Harsha; Purohit, Aniruddh K; Ankathi, Praveen; Prasad, Komal; Mariswamappa, Kiran; Lakshmikantha, Akhila; Uppin, Megha S; Sundaram, Challa; Gautam, Poonam; Sirdeshmukh, Ravi. Altered transcriptional regulatory proteins in glioblastoma and YBX1 as a potential regulator of tumor invasion. Scientific Reports. 2019;9(1):10986. PubMed |
| Wasielica-Berger, Justyna; Rogalski, Paweł; Świdnicka-Siergiejko, Agnieszka; Pryczynicz, Anna; Kiśluk, Joanna; Daniluk, Jarosław; Antonowicz, Stefania; Maślach, Dominik; Krzyżak, Michalina; Dąbrowski, Andrzej. Expression of VEGF, EGF, and Their Receptors in Squamous Esophageal Mucosa, with Correlations to Histological Findings and Endoscopic Minimal Changes, in Patients with Different GERD Phenotypes. International Journal Of Environmental Research And Public Health. 2022;19(9) PubMed |
| Arabi, Azadeh; Ullah, Karim; Branca, Rui M M; Johansson, Johan; Bandarra, Daniel; Haneklaus, Moritz; Fu, Jing; Ariës, Ingrid; Nilsson, Peter; Den Boer, Monique L; Pokrovskaja, Katja; Grandér, Dan; Xiao, Gutian; Rocha, Sonia; Lehtiö, Janne; Sangfelt, Olle. Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway. Nature Communications. 3( 22864569):976. PubMed |
| Luke, Geoffrey P; Myers, Jeffrey N; Emelianov, Stanislav Y; Sokolov, Konstantin V. Sentinel lymph node biopsy revisited: ultrasound-guided photoacoustic detection of micrometastases using molecularly targeted plasmonic nanosensors. Cancer Research. 2014;74(19):5397-408. PubMed |
| Galardi, Silvia; Savino, Mauro; Scagnoli, Fiorella; Pellegatta, Serena; Pisati, Federica; Zambelli, Federico; Illi, Barbara; Annibali, Daniela; Beji, Sara; Orecchini, Elisa; Alberelli, Maria Adele; Apicella, Clara; Fontanella, Rosaria Anna; Michienzi, Alessandro; Finocchiaro, Gaetano; Farace, Maria Giulia; Pavesi, Giulio; Ciafrè, Silvia Anna; Nasi, Sergio. Resetting cancer stem cell regulatory nodes upon MYC inhibition. Embo Reports. 2016;17(12):1872-1889. PubMed |
| Yazdankhah, Meysam; Shang, Peng; Ghosh, Sayan; Bhutto, Imran A; Stepicheva, Nadezda; Grebe, Rhonda; Hose, Stacey; Weiss, Joseph; Luo, Tianqi; Mishra, Subrata; Riazuddin, S Amer; Ghosh, Arkasubhra; Handa, James T; Lutty, Gerard A; Zigler, J Samuel Jr; Sinha, Debasish. Modulating EGFR-MTORC1-autophagy as a potential therapy for persistent fetal vasculature (PFV) disease. Autophagy. 2020;16(6):1130-1142. PubMed |
| Haag, Andrea; Walser, Michael; Henggeler, Adrian; Hajnal, Alex. The CHORD protein CHP-1 regulates EGF receptor trafficking and signaling in C. elegans and in human cells. Elife. 2020;9( 32053105) PubMed |
| Sano, Kazumi; Nakadate, Kazuhiko; Hanada, Kazuhiko. Minocycline prevents and repairs the skin disorder associated with afatinib, one of the epidermal growth factor receptor-tyrosine kinase inhibitors for non-small cell lung cancer. Bmc Cancer. 2020;20(1):279. PubMed |
| da Silva, Jesse Lopes; Rodrigues, Fabiana Resende; de Mesquita, Guilherme Gomes; Fernandes, Priscila Valverde; Thuler, Luiz Claudio Santos; de Melo, Andreia Cristina. Triple-Negative Breast Cancer: Assessing the Role of Immunohistochemical Biomarkers on Neoadjuvant Treatment. Breast Cancer (Dove Medical Press). 13( 33469357):31-44. PubMed |
| Nowińska, Katarzyna; Jabłońska, Karolina; Ciesielska, Urszula; Piotrowska, Aleksandra; Haczkiewicz-Leśniak, Katarzyna; Pawełczyk, Konrad; Podhorska-Okołów, Marzenna; Dzięgiel, Piotr. Association of Irisin/FNDC5 with ERRα and PGC-1α Expression in NSCLC. International Journal Of Molecular Sciences. 2022;23(22) PubMed |