Anti EGFL8 pAb (ATL-HPA061173)

Atlas Antibodies

Catalog No.:
ATL-HPA061173-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EGF-like-domain, multiple 8
Gene Name: EGFL8
Alternative Gene Name: C6orf8, NG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015467: 71%, ENSRNOG00000000436: 66%
Entrez Gene ID: 80864
Uniprot ID: Q99944
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG
Gene Sequence FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG
Gene ID - Mouse ENSMUSG00000015467
Gene ID - Rat ENSRNOG00000000436
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EGFL8 pAb (ATL-HPA061173)
Datasheet Anti EGFL8 pAb (ATL-HPA061173) Datasheet (External Link)
Vendor Page Anti EGFL8 pAb (ATL-HPA061173) at Atlas Antibodies

Documents & Links for Anti EGFL8 pAb (ATL-HPA061173)
Datasheet Anti EGFL8 pAb (ATL-HPA061173) Datasheet (External Link)
Vendor Page Anti EGFL8 pAb (ATL-HPA061173)