Anti EGFL8 pAb (ATL-HPA061173)

Atlas Antibodies

Catalog No.: ATL-HPA061173-25

Protein Description: EGF-like-domain, multiple 8
Gene Name: EGFL8
Alternative Gene Name: C6orf8, NG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015467: 71%, ENSRNOG00000000436: 66%
Entrez Gene ID: 80864
Uniprot ID: Q99944
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG
• Gene Sequence: FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG
• Gene ID - Mouse: ENSMUSG00000015467
• Gene ID - Rat: ENSRNOG00000000436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.