Anti EGFL7 pAb (ATL-HPA050716)

Atlas Antibodies

Catalog No.:
ATL-HPA050716-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EGF like domain multiple 7
Gene Name: EGFL7
Alternative Gene Name: ZNEU1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026921: 75%, ENSRNOG00000019388: 75%
Entrez Gene ID: 51162
Uniprot ID: Q9UHF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD
Gene Sequence RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD
Gene ID - Mouse ENSMUSG00000026921
Gene ID - Rat ENSRNOG00000019388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EGFL7 pAb (ATL-HPA050716)
Datasheet Anti EGFL7 pAb (ATL-HPA050716) Datasheet (External Link)
Vendor Page Anti EGFL7 pAb (ATL-HPA050716) at Atlas Antibodies

Documents & Links for Anti EGFL7 pAb (ATL-HPA050716)
Datasheet Anti EGFL7 pAb (ATL-HPA050716) Datasheet (External Link)
Vendor Page Anti EGFL7 pAb (ATL-HPA050716)