Anti EGFL7 pAb (ATL-HPA050716)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050716-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EGFL7
Alternative Gene Name: ZNEU1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026921: 75%, ENSRNOG00000019388: 75%
Entrez Gene ID: 51162
Uniprot ID: Q9UHF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD |
Gene Sequence | RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD |
Gene ID - Mouse | ENSMUSG00000026921 |
Gene ID - Rat | ENSRNOG00000019388 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EGFL7 pAb (ATL-HPA050716) | |
Datasheet | Anti EGFL7 pAb (ATL-HPA050716) Datasheet (External Link) |
Vendor Page | Anti EGFL7 pAb (ATL-HPA050716) at Atlas Antibodies |
Documents & Links for Anti EGFL7 pAb (ATL-HPA050716) | |
Datasheet | Anti EGFL7 pAb (ATL-HPA050716) Datasheet (External Link) |
Vendor Page | Anti EGFL7 pAb (ATL-HPA050716) |