Anti EFS pAb (ATL-HPA001581)

Atlas Antibodies

SKU:
ATL-HPA001581-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic and membranous positivity in bile duct cells.
  • Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: embryonal Fyn-associated substrate
Gene Name: EFS
Alternative Gene Name: CASS3, EFS1, EFS2, HEFS, SIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022203: 77%, ENSRNOG00000042029: 78%
Entrez Gene ID: 10278
Uniprot ID: O43281
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IYKIPRASGTQLAAPRDALEVYDVPPTALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALAS
Gene Sequence IYKIPRASGTQLAAPRDALEVYDVPPTALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALAS
Gene ID - Mouse ENSMUSG00000022203
Gene ID - Rat ENSRNOG00000042029
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EFS pAb (ATL-HPA001581)
Datasheet Anti EFS pAb (ATL-HPA001581) Datasheet (External Link)
Vendor Page Anti EFS pAb (ATL-HPA001581) at Atlas Antibodies

Documents & Links for Anti EFS pAb (ATL-HPA001581)
Datasheet Anti EFS pAb (ATL-HPA001581) Datasheet (External Link)
Vendor Page Anti EFS pAb (ATL-HPA001581)