Anti EFR3A pAb (ATL-HPA023092 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023092-25

Protein Description: EFR3 homolog A (S. cerevisiae)
Gene Name: EFR3A
Alternative Gene Name: KIAA0143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015002: 100%, ENSRNOG00000025528: 100%
Entrez Gene ID: 23167
Uniprot ID: Q14156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVADLKIKREKICRQDTSFMK
• Gene Sequence: LLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVADLKIKREKICRQDTSFMK
• Gene ID - Mouse: ENSMUSG00000015002
• Gene ID - Rat: ENSRNOG00000025528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EFR3A pAb (ATL-HPA023092 w/enhanced validation) – 1 Found

Koester, Anna M; Geiser, Angéline; Laidlaw, Kamilla M E; Morris, Silke; Cutiongco, Marie F A; Stirrat, Laura; Gadegaard, Nikolaj; Boles, Eckhard; Black, Hannah L; Bryant, Nia J; Gould, Gwyn W. EFR3 and phosphatidylinositol 4-kinase IIIα regulate insulin-stimulated glucose transport and GLUT4 dispersal in 3T3-L1 adipocytes. Bioscience Reports. 2022;42(7)