Anti EFR3A pAb (ATL-HPA022859 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA022859-25
  • Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-EFR3A antibody HPA022859 (A) shows similar protein distribution across tissues to independent antibody HPA023092 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EFR3 homolog A (S. cerevisiae)
Gene Name: EFR3A
Alternative Gene Name: KIAA0143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015002: 96%, ENSRNOG00000025528: 96%
Entrez Gene ID: 23167
Uniprot ID: Q14156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLL
Gene Sequence NTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLL
Gene ID - Mouse ENSMUSG00000015002
Gene ID - Rat ENSRNOG00000025528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EFR3A pAb (ATL-HPA022859 w/enhanced validation)
Datasheet Anti EFR3A pAb (ATL-HPA022859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EFR3A pAb (ATL-HPA022859 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EFR3A pAb (ATL-HPA022859 w/enhanced validation)
Datasheet Anti EFR3A pAb (ATL-HPA022859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EFR3A pAb (ATL-HPA022859 w/enhanced validation)