Anti EFNB2 pAb (ATL-HPA008999)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008999-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EFNB2
Alternative Gene Name: EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001300: 97%, ENSRNOG00000014648: 97%
Entrez Gene ID: 1948
Uniprot ID: P52799
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP |
Gene Sequence | YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP |
Gene ID - Mouse | ENSMUSG00000001300 |
Gene ID - Rat | ENSRNOG00000014648 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFNB2 pAb (ATL-HPA008999) | |
Datasheet | Anti EFNB2 pAb (ATL-HPA008999) Datasheet (External Link) |
Vendor Page | Anti EFNB2 pAb (ATL-HPA008999) at Atlas Antibodies |
Documents & Links for Anti EFNB2 pAb (ATL-HPA008999) | |
Datasheet | Anti EFNB2 pAb (ATL-HPA008999) Datasheet (External Link) |
Vendor Page | Anti EFNB2 pAb (ATL-HPA008999) |
Citations for Anti EFNB2 pAb (ATL-HPA008999) – 6 Found |
Lagares, David; Ghassemi-Kakroodi, Parisa; Tremblay, Caroline; Santos, Alba; Probst, Clemens K; Franklin, Alicia; Santos, Daniela M; Grasberger, Paula; Ahluwalia, Neil; Montesi, Sydney B; Shea, Barry S; Black, Katharine E; Knipe, Rachel; Blati, Meryem; Baron, Murray; Wu, Brian; Fahmi, Hassan; Gandhi, Rajiv; Pardo, Annie; Selman, Moisés; Wu, Jiangping; Pelletier, Jean-Pierre; Martel-Pelletier, Johanne; Tager, Andrew M; Kapoor, Mohit. ADAM10-mediated ephrin-B2 shedding promotes myofibroblast activation and organ fibrosis. Nature Medicine. 2017;23(12):1405-1415. PubMed |
Nakayama, Masanori; Nakayama, Akiko; van Lessen, Max; Yamamoto, Hiroyuki; Hoffmann, Sarah; Drexler, Hannes C A; Itoh, Norimichi; Hirose, Tomonori; Breier, Georg; Vestweber, Dietmar; Cooper, Jonathan A; Ohno, Shigeo; Kaibuchi, Kozo; Adams, Ralf H. Spatial regulation of VEGF receptor endocytosis in angiogenesis. Nature Cell Biology. 2013;15(3):249-60. PubMed |
Nakayama, Akiko; Nakayama, Masanori; Turner, Christopher J; Höing, Susanne; Lepore, John J; Adams, Ralf H. Ephrin-B2 controls PDGFRβ internalization and signaling. Genes & Development. 2013;27(23):2576-89. PubMed |
Chen, Sisi; Bremer, Andrew W; Scheideler, Olivia J; Na, Yun Suk; Todhunter, Michael E; Hsiao, Sonny; Bomdica, Prithvi R; Maharbiz, Michel M; Gartner, Zev J; Schaffer, David V. Interrogating cellular fate decisions with high-throughput arrays of multiplexed cellular communities. Nature Communications. 2016;7( 26754526):10309. PubMed |
Fehnel, Katie Pricola; Penn, David L; Duggins-Warf, Micah; Gruber, Maxwell; Pineda, Steven; Sesen, Julie; Moses-Gardner, Alexander; Shah, Nishali; Driscoll, Jessica; Zurakowski, David; Orbach, Darren B; Smith, Edward R. Dysregulation of the EphrinB2-EphB4 ratio in pediatric cerebral arteriovenous malformations is associated with endothelial cell dysfunction in vitro and functions as a novel noninvasive biomarker in patients. Experimental & Molecular Medicine. 2020;52(4):658-671. PubMed |
Schwickert, Alexander; Henrich, Wolfgang; Vogel, Martin; Melchior, Kerstin; Ehrlich, Loreen; Ochs, Matthias; Braun, Thorsten. Placenta Percreta Presents with Neoangiogenesis of Arteries with Von Willebrand Factor-Negative Endothelium. Reproductive Sciences (Thousand Oaks, Calif.). 2022;29(4):1136-1144. PubMed |