Anti EFNB1 pAb (ATL-HPA067188)

Atlas Antibodies

Catalog No.:
ATL-HPA067188-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ephrin-B1
Gene Name: EFNB1
Alternative Gene Name: CFNS, Elk-L, EPLG2, LERK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031217: 93%, ENSRNOG00000006877: 92%
Entrez Gene ID: 1947
Uniprot ID: P98172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGA
Gene Sequence VGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGA
Gene ID - Mouse ENSMUSG00000031217
Gene ID - Rat ENSRNOG00000006877
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFNB1 pAb (ATL-HPA067188)
Datasheet Anti EFNB1 pAb (ATL-HPA067188) Datasheet (External Link)
Vendor Page Anti EFNB1 pAb (ATL-HPA067188) at Atlas Antibodies

Documents & Links for Anti EFNB1 pAb (ATL-HPA067188)
Datasheet Anti EFNB1 pAb (ATL-HPA067188) Datasheet (External Link)
Vendor Page Anti EFNB1 pAb (ATL-HPA067188)