Anti EFNA5 pAb (ATL-HPA054047)

Atlas Antibodies

Catalog No.:
ATL-HPA054047-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ephrin-A5
Gene Name: EFNA5
Alternative Gene Name: AF1, EPLG7, LERK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048915: 100%, ENSRNOG00000034177: 100%
Entrez Gene ID: 1946
Uniprot ID: P52803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Gene Sequence FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Gene ID - Mouse ENSMUSG00000048915
Gene ID - Rat ENSRNOG00000034177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFNA5 pAb (ATL-HPA054047)
Datasheet Anti EFNA5 pAb (ATL-HPA054047) Datasheet (External Link)
Vendor Page Anti EFNA5 pAb (ATL-HPA054047) at Atlas Antibodies

Documents & Links for Anti EFNA5 pAb (ATL-HPA054047)
Datasheet Anti EFNA5 pAb (ATL-HPA054047) Datasheet (External Link)
Vendor Page Anti EFNA5 pAb (ATL-HPA054047)