Anti EFNA5 pAb (ATL-HPA054047)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054047-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EFNA5
Alternative Gene Name: AF1, EPLG7, LERK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048915: 100%, ENSRNOG00000034177: 100%
Entrez Gene ID: 1946
Uniprot ID: P52803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ |
Gene Sequence | FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ |
Gene ID - Mouse | ENSMUSG00000048915 |
Gene ID - Rat | ENSRNOG00000034177 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFNA5 pAb (ATL-HPA054047) | |
Datasheet | Anti EFNA5 pAb (ATL-HPA054047) Datasheet (External Link) |
Vendor Page | Anti EFNA5 pAb (ATL-HPA054047) at Atlas Antibodies |
Documents & Links for Anti EFNA5 pAb (ATL-HPA054047) | |
Datasheet | Anti EFNA5 pAb (ATL-HPA054047) Datasheet (External Link) |
Vendor Page | Anti EFNA5 pAb (ATL-HPA054047) |