Anti EFNA2 pAb (ATL-HPA067567)

Atlas Antibodies

Catalog No.:
ATL-HPA067567-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ephrin A2
Gene Name: EFNA2
Alternative Gene Name: ELF-1, EPLG6, LERK6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003070: 88%, ENSRNOG00000016203: 88%
Entrez Gene ID: 1943
Uniprot ID: O43921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Gene Sequence PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Gene ID - Mouse ENSMUSG00000003070
Gene ID - Rat ENSRNOG00000016203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFNA2 pAb (ATL-HPA067567)
Datasheet Anti EFNA2 pAb (ATL-HPA067567) Datasheet (External Link)
Vendor Page Anti EFNA2 pAb (ATL-HPA067567) at Atlas Antibodies

Documents & Links for Anti EFNA2 pAb (ATL-HPA067567)
Datasheet Anti EFNA2 pAb (ATL-HPA067567) Datasheet (External Link)
Vendor Page Anti EFNA2 pAb (ATL-HPA067567)