Anti EFL1 pAb (ATL-HPA039654)

Atlas Antibodies

Catalog No.:
ATL-HPA039654-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: elongation factor like GTPase 1
Gene Name: EFL1
Alternative Gene Name: EFTUD1, FAM42A, FLJ13119, HsT19294, RIA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038563: 86%, ENSRNOG00000032723: 85%
Entrez Gene ID: 79631
Uniprot ID: Q7Z2Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDLIRSMEQLTSSLNEGENTHMIHQKTQEKIWEFKGKLEQHLTGRRWRNIVDQIWSFGPRKCGPNILVNKSEDFQNSVWTGPADKASKEASRYRDLGNSIVSGFQLATL
Gene Sequence SDLIRSMEQLTSSLNEGENTHMIHQKTQEKIWEFKGKLEQHLTGRRWRNIVDQIWSFGPRKCGPNILVNKSEDFQNSVWTGPADKASKEASRYRDLGNSIVSGFQLATL
Gene ID - Mouse ENSMUSG00000038563
Gene ID - Rat ENSRNOG00000032723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFL1 pAb (ATL-HPA039654)
Datasheet Anti EFL1 pAb (ATL-HPA039654) Datasheet (External Link)
Vendor Page Anti EFL1 pAb (ATL-HPA039654) at Atlas Antibodies

Documents & Links for Anti EFL1 pAb (ATL-HPA039654)
Datasheet Anti EFL1 pAb (ATL-HPA039654) Datasheet (External Link)
Vendor Page Anti EFL1 pAb (ATL-HPA039654)