Anti EFHC2 pAb (ATL-HPA034492)

Atlas Antibodies

SKU:
ATL-HPA034492-25
  • Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Mouse Cerebral Cortex tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EF-hand domain (C-terminal) containing 2
Gene Name: EFHC2
Alternative Gene Name: FLJ22843, MRX74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025038: 76%, ENSRNOG00000002986: 80%
Entrez Gene ID: 80258
Uniprot ID: Q5JST6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen KEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIR
Gene Sequence KEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIR
Gene ID - Mouse ENSMUSG00000025038
Gene ID - Rat ENSRNOG00000002986
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EFHC2 pAb (ATL-HPA034492)
Datasheet Anti EFHC2 pAb (ATL-HPA034492) Datasheet (External Link)
Vendor Page Anti EFHC2 pAb (ATL-HPA034492) at Atlas Antibodies

Documents & Links for Anti EFHC2 pAb (ATL-HPA034492)
Datasheet Anti EFHC2 pAb (ATL-HPA034492) Datasheet (External Link)
Vendor Page Anti EFHC2 pAb (ATL-HPA034492)