Anti EFHC1 pAb (ATL-HPA035307)
Atlas Antibodies
- SKU:
- ATL-HPA035307-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EFHC1
Alternative Gene Name: EJM, EJM1, FLJ10466
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041809: 66%, ENSRNOG00000042729: 66%
Entrez Gene ID: 114327
Uniprot ID: Q5JVL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAF |
Gene Sequence | ESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAF |
Gene ID - Mouse | ENSMUSG00000041809 |
Gene ID - Rat | ENSRNOG00000042729 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFHC1 pAb (ATL-HPA035307) | |
Datasheet | Anti EFHC1 pAb (ATL-HPA035307) Datasheet (External Link) |
Vendor Page | Anti EFHC1 pAb (ATL-HPA035307) at Atlas Antibodies |
Documents & Links for Anti EFHC1 pAb (ATL-HPA035307) | |
Datasheet | Anti EFHC1 pAb (ATL-HPA035307) Datasheet (External Link) |
Vendor Page | Anti EFHC1 pAb (ATL-HPA035307) |