Anti EFHC1 pAb (ATL-HPA035307)

Atlas Antibodies

Catalog No.:
ATL-HPA035307-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EF-hand domain (C-terminal) containing 1
Gene Name: EFHC1
Alternative Gene Name: EJM, EJM1, FLJ10466
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041809: 66%, ENSRNOG00000042729: 66%
Entrez Gene ID: 114327
Uniprot ID: Q5JVL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAF
Gene Sequence ESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAF
Gene ID - Mouse ENSMUSG00000041809
Gene ID - Rat ENSRNOG00000042729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFHC1 pAb (ATL-HPA035307)
Datasheet Anti EFHC1 pAb (ATL-HPA035307) Datasheet (External Link)
Vendor Page Anti EFHC1 pAb (ATL-HPA035307) at Atlas Antibodies

Documents & Links for Anti EFHC1 pAb (ATL-HPA035307)
Datasheet Anti EFHC1 pAb (ATL-HPA035307) Datasheet (External Link)
Vendor Page Anti EFHC1 pAb (ATL-HPA035307)