Anti EFHC1 pAb (ATL-HPA035307)

Atlas Antibodies

Catalog No.: ATL-HPA035307-25

Protein Description: EF-hand domain (C-terminal) containing 1
Gene Name: EFHC1
Alternative Gene Name: EJM, EJM1, FLJ10466
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041809: 66%, ENSRNOG00000042729: 66%
Entrez Gene ID: 114327
Uniprot ID: Q5JVL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAF
• Gene Sequence: ESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAF
• Gene ID - Mouse: ENSMUSG00000041809
• Gene ID - Rat: ENSRNOG00000042729
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.