Anti EFEMP2 pAb (ATL-HPA023270)

Atlas Antibodies

SKU: ATL-HPA023270-25

• 

Protein Description: EGF containing fibulin-like extracellular matrix protein 2
Gene Name: EFEMP2
Alternative Gene Name: FBLN4, UPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024909: 93%, ENSRNOG00000020587: 93%
Entrez Gene ID: 30008
Uniprot ID: O95967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHR
• Gene Sequence: RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHR
• Gene ID - Mouse: ENSMUSG00000024909
• Gene ID - Rat: ENSRNOG00000020587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.