Anti EFCC1 pAb (ATL-HPA050888)

Atlas Antibodies

Catalog No.:
ATL-HPA050888-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EF-hand and coiled-coil domain containing 1
Gene Name: EFCC1
Alternative Gene Name: C3orf73, CCDC48, FLJ12057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068263: 64%, ENSRNOG00000009787: 58%
Entrez Gene ID: 79825
Uniprot ID: Q9HA90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTSEEEAELQQKVEENEHLRLELQMVETERVRLS
Gene Sequence MTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTSEEEAELQQKVEENEHLRLELQMVETERVRLS
Gene ID - Mouse ENSMUSG00000068263
Gene ID - Rat ENSRNOG00000009787
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCC1 pAb (ATL-HPA050888)
Datasheet Anti EFCC1 pAb (ATL-HPA050888) Datasheet (External Link)
Vendor Page Anti EFCC1 pAb (ATL-HPA050888) at Atlas Antibodies

Documents & Links for Anti EFCC1 pAb (ATL-HPA050888)
Datasheet Anti EFCC1 pAb (ATL-HPA050888) Datasheet (External Link)
Vendor Page Anti EFCC1 pAb (ATL-HPA050888)