Anti EFCC1 pAb (ATL-HPA042798)
Atlas Antibodies
- SKU:
- ATL-HPA042798-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EFCC1
Alternative Gene Name: C3orf73, CCDC48, FLJ12057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068263: 75%, ENSRNOG00000009787: 72%
Entrez Gene ID: 79825
Uniprot ID: Q9HA90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPAS |
Gene Sequence | SLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPAS |
Gene ID - Mouse | ENSMUSG00000068263 |
Gene ID - Rat | ENSRNOG00000009787 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFCC1 pAb (ATL-HPA042798) | |
Datasheet | Anti EFCC1 pAb (ATL-HPA042798) Datasheet (External Link) |
Vendor Page | Anti EFCC1 pAb (ATL-HPA042798) at Atlas Antibodies |
Documents & Links for Anti EFCC1 pAb (ATL-HPA042798) | |
Datasheet | Anti EFCC1 pAb (ATL-HPA042798) Datasheet (External Link) |
Vendor Page | Anti EFCC1 pAb (ATL-HPA042798) |