Anti EFCC1 pAb (ATL-HPA042798)

Atlas Antibodies

Catalog No.: ATL-HPA042798-25

Protein Description: EF-hand and coiled-coil domain containing 1
Gene Name: EFCC1
Alternative Gene Name: C3orf73, CCDC48, FLJ12057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068263: 75%, ENSRNOG00000009787: 72%
Entrez Gene ID: 79825
Uniprot ID: Q9HA90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPAS
• Gene Sequence: SLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPAS
• Gene ID - Mouse: ENSMUSG00000068263
• Gene ID - Rat: ENSRNOG00000009787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.