Anti EFCAB8 pAb (ATL-HPA042751)

Atlas Antibodies

Catalog No.:
ATL-HPA042751-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 8
Gene Name: EFCAB8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044083: 37%, ENSRNOG00000027920: 42%
Entrez Gene ID: 388795
Uniprot ID: A8MWE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSSEDLAEIPQLQKLSIPHGFQNKEAASSPTPSITLSQVPDLQPGSQLFTEIHLAKIEKMFEEDINSTGALGMDAFIKAMK
Gene Sequence MSSEDLAEIPQLQKLSIPHGFQNKEAASSPTPSITLSQVPDLQPGSQLFTEIHLAKIEKMFEEDINSTGALGMDAFIKAMK
Gene ID - Mouse ENSMUSG00000044083
Gene ID - Rat ENSRNOG00000027920
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCAB8 pAb (ATL-HPA042751)
Datasheet Anti EFCAB8 pAb (ATL-HPA042751) Datasheet (External Link)
Vendor Page Anti EFCAB8 pAb (ATL-HPA042751) at Atlas Antibodies

Documents & Links for Anti EFCAB8 pAb (ATL-HPA042751)
Datasheet Anti EFCAB8 pAb (ATL-HPA042751) Datasheet (External Link)
Vendor Page Anti EFCAB8 pAb (ATL-HPA042751)