Anti EFCAB7 pAb (ATL-HPA029611)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029611-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EFCAB7
Alternative Gene Name: KIAA1799, RP4-534K7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073791: 90%, ENSRNOG00000009782: 87%
Entrez Gene ID: 84455
Uniprot ID: A8K855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTRQGFMDLNLMEANDREGDPCDLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNGDAKVMDGYENI |
| Gene Sequence | LTRQGFMDLNLMEANDREGDPCDLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNGDAKVMDGYENI |
| Gene ID - Mouse | ENSMUSG00000073791 |
| Gene ID - Rat | ENSRNOG00000009782 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EFCAB7 pAb (ATL-HPA029611) | |
| Datasheet | Anti EFCAB7 pAb (ATL-HPA029611) Datasheet (External Link) |
| Vendor Page | Anti EFCAB7 pAb (ATL-HPA029611) at Atlas Antibodies |
| Documents & Links for Anti EFCAB7 pAb (ATL-HPA029611) | |
| Datasheet | Anti EFCAB7 pAb (ATL-HPA029611) Datasheet (External Link) |
| Vendor Page | Anti EFCAB7 pAb (ATL-HPA029611) |