Anti EFCAB7 pAb (ATL-HPA029611)

Atlas Antibodies

Catalog No.:
ATL-HPA029611-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 7
Gene Name: EFCAB7
Alternative Gene Name: KIAA1799, RP4-534K7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073791: 90%, ENSRNOG00000009782: 87%
Entrez Gene ID: 84455
Uniprot ID: A8K855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTRQGFMDLNLMEANDREGDPCDLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNGDAKVMDGYENI
Gene Sequence LTRQGFMDLNLMEANDREGDPCDLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNGDAKVMDGYENI
Gene ID - Mouse ENSMUSG00000073791
Gene ID - Rat ENSRNOG00000009782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCAB7 pAb (ATL-HPA029611)
Datasheet Anti EFCAB7 pAb (ATL-HPA029611) Datasheet (External Link)
Vendor Page Anti EFCAB7 pAb (ATL-HPA029611) at Atlas Antibodies

Documents & Links for Anti EFCAB7 pAb (ATL-HPA029611)
Datasheet Anti EFCAB7 pAb (ATL-HPA029611) Datasheet (External Link)
Vendor Page Anti EFCAB7 pAb (ATL-HPA029611)