Anti EFCAB2 pAb (ATL-HPA031207)

Atlas Antibodies

Catalog No.:
ATL-HPA031207-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: EF-hand calcium binding domain 2
Gene Name: EFCAB2
Alternative Gene Name: CFAP200, DRC8, MGC12458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026495: 28%, ENSRNOG00000042201: 31%
Entrez Gene ID: 84288
Uniprot ID: Q5VUJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLGISQATGSAARWRTRRTGKGLGYNSDEIRPRTLLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVR
Gene Sequence SLGISQATGSAARWRTRRTGKGLGYNSDEIRPRTLLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVR
Gene ID - Mouse ENSMUSG00000026495
Gene ID - Rat ENSRNOG00000042201
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EFCAB2 pAb (ATL-HPA031207)
Datasheet Anti EFCAB2 pAb (ATL-HPA031207) Datasheet (External Link)
Vendor Page Anti EFCAB2 pAb (ATL-HPA031207) at Atlas Antibodies

Documents & Links for Anti EFCAB2 pAb (ATL-HPA031207)
Datasheet Anti EFCAB2 pAb (ATL-HPA031207) Datasheet (External Link)
Vendor Page Anti EFCAB2 pAb (ATL-HPA031207)