Anti EFCAB2 pAb (ATL-HPA031207)

Atlas Antibodies

Catalog No.: ATL-HPA031207-25

Protein Description: EF-hand calcium binding domain 2
Gene Name: EFCAB2
Alternative Gene Name: CFAP200, DRC8, MGC12458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026495: 28%, ENSRNOG00000042201: 31%
Entrez Gene ID: 84288
Uniprot ID: Q5VUJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLGISQATGSAARWRTRRTGKGLGYNSDEIRPRTLLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVR
• Gene Sequence: SLGISQATGSAARWRTRRTGKGLGYNSDEIRPRTLLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVR
• Gene ID - Mouse: ENSMUSG00000026495
• Gene ID - Rat: ENSRNOG00000042201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.