Anti EFCAB2 pAb (ATL-HPA031206)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031206-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EFCAB2
Alternative Gene Name: CFAP200, DRC8, MGC12458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026495: 80%, ENSRNOG00000042201: 81%
Entrez Gene ID: 84288
Uniprot ID: Q5VUJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEDGVSL |
Gene Sequence | RSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEDGVSL |
Gene ID - Mouse | ENSMUSG00000026495 |
Gene ID - Rat | ENSRNOG00000042201 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EFCAB2 pAb (ATL-HPA031206) | |
Datasheet | Anti EFCAB2 pAb (ATL-HPA031206) Datasheet (External Link) |
Vendor Page | Anti EFCAB2 pAb (ATL-HPA031206) at Atlas Antibodies |
Documents & Links for Anti EFCAB2 pAb (ATL-HPA031206) | |
Datasheet | Anti EFCAB2 pAb (ATL-HPA031206) Datasheet (External Link) |
Vendor Page | Anti EFCAB2 pAb (ATL-HPA031206) |